PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01326g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 464aa    MW: 51209.1 Da    PI: 6.2759
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01326g00005.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.62.7e-38113171260
                    zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                               ++k+l+cprC+st+tkfCy+nny++sqPr+fCk+C+ryWt+GG++rnvPvG+grrk+k+
  Niben101Scf01326g00005.1 113 PDKTLPCPRCNSTETKFCYFNNYNVSQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKHKN 171
                               7899****************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-28110170IPR003851Zinc finger, Dof-type
PfamPF027012.3E-31115171IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.658117171IPR003851Zinc finger, Dof-type
PROSITE patternPS013610119155IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 464 aa     Download sequence    Send to blast
MSEAIANKDP VIKLFGRTIQ LPDFPTPSPA DTGDHSSSAG EAELEHKGEC DDCKDENKHL  60
IAEELQDRNP IPEKSDIIEV SPSYNDCSTA KTSKSEEEQA ETSNSHEKIL KKPDKTLPCP  120
RCNSTETKFC YFNNYNVSQP RHFCKNCQRY WTAGGTMRNV PVGAGRRKHK NPVLHYRHIS  180
VSETLTDLSN GIQPPPLKLN GTILAFNTDK PLCESMSSVL NIADKTMQNC PENGFHRYKE  240
LGIQAGDNGD DRSDGSSVTA VSSKDSDNGS PDMPRQKYDS FSPHLPCFTG APWPYPWSSV  300
HLSDAVPPPG YYFPGFPMPF VPAYWGCVIP GSWNIPWMSP PTASQNQMPP TSSPNSPALG  360
KHPRDEIILK SMGSEEEPRN ESNPPEKCLW FPKTLRIGDP GEAAKSSIWS TLGIKHDVVD  420
SVSGRSFKAF LPKSDERNHV SENSSVLKAN PAAMSRSLNF NESS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009792864.10.0PREDICTED: cyclic dof factor 3-like
TrEMBLM0ZLI40.0M0ZLI4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000033590.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53224122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.21e-87cycling DOF factor 2